PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G099200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 569aa    MW: 61093.2 Da    PI: 8.3081
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G099200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.21.8e-103463831954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  Brast08G099200.1.p 346 FEHflHPYPTDSDKQMLAKQTGLTRNQVSNWFINARVR 383
                         554459******************************88 PP

2BELL95.54.6e-31205274372
                BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +e q +k++L+sl+eeV+krYkqy++qlq+vissFe+vagl +a+p++s+Al+++S+hF+ Lk +i +q+
  Brast08G099200.1.p 205 AEQQWRKTRLISLMEEVCKRYKQYYQQLQAVISSFETVAGLSNAAPFASIALRTMSKHFKYLKGMIQSQL 274
                         58899**************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.5E-36137272IPR006563POX domain
PfamPF075267.2E-36142270IPR006563POX domain
PROSITE profilePS5007112.455324387IPR001356Homeobox domain
CDDcd000865.93E-14327388No hitNo description
SMARTSM003891.4E-11327391IPR001356Homeobox domain
SuperFamilySSF466892.91E-17329394IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-29330391IPR009057Homeodomain-like
PfamPF059205.0E-19344383IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MSSAAGGGYG QGGGGGEQHQ LLLGQAAAGQ LYHVPQHSRR EKLRFPPDHP AADSPTAAPP  60
GSSSSWPPPP PPFYSYASSS ASSYSPHSPS SLAQAQAQAQ LVASHAAQIP SQNFALSLSS  120
NPPPRRQLAG GPYGPFTGYA AVLGRSRFLG PAQKLLEEIC DVGARPARQV DRPGPPDDGL  180
LDMDDAMDDD AGHEMDGEAV TVSGAEQQWR KTRLISLMEE VCKRYKQYYQ QLQAVISSFE  240
TVAGLSNAAP FASIALRTMS KHFKYLKGMI QSQLRNTSKQ VAVAGKDGLG KEDMASFGLM  300
GGSASAGATL MRGSNVNAFG QQPHNIWRPQ RGLPERAVSV LRAWLFEHFL HPYPTDSDKQ  360
MLAKQTGLTR NQVSNWFINA RVRLWKPMVE EIHNLEMRQG HKNSSVDKNH LGMQQIQHSP  420
DSSGRPSDPS NSQQGQSSSM TRNHSTHGSR HIQNELSPMT HDMPGQVSFA YSGLQAAHHN  480
IALSHPQQVL GVGVGGAGNG GGVSLTLGLH QDNRTYIAEP LPAALPLNLA HRFGLEDVSD  540
AYVMGSFGGQ DRHFTKEIGG HLLHDFVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B4e-17333390158Homeobox protein Meis1
4xrs_A4e-17333390158Homeobox protein Meis1
5bng_A5e-17333391159Homeobox protein Meis2
5bng_B5e-17333391159Homeobox protein Meis2
3k2a_B5e-17333391563Homeobox protein Meis2
3k2a_A5e-17333391563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568329.20.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A0Q3G6C20.0A0A0Q3G6C2_BRADI; Uncharacterized protein
STRINGBRADI2G23530.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-75TALE family protein